PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G1607
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 384aa    MW: 41765.7 Da    PI: 5.4794
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G1607genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.8e-11162213556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +   
  Gh_A10G1607 162 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDT 213
                  9****************************************99987766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-17158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622160223IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.6E-11162216No hitNo description
PfamPF001702.4E-9162211IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11162213No hitNo description
CDDcd147031.11E-24163212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MQDPPSLKPN PDPPVPSNAS STTPSFPNPT TFRGSYHRRA QSEVQFRIPD DLDLVSDPFE  60
GMGSEDDLFC SYMDIEKLGG SSKGAEEGRG ATGSSTAGSA HNPKGDEISG GSAGMGEKTN  120
EGGKGTHRYS NSVDGCSLME SIEAKKAMAP DKLAELWTID PKRAKRIIAN RQSAARSKER  180
KARYISELER KVQTLQTEAT TLSAQLTLFQ RDTTGLTTEN TELKLRLQAM EQQAQLRDAL  240
NEALKKEVER LKMATGEMST PTDNFNLGMH HIPFTQSSFF PPQPRQVETQ NMQMPPFHPL  300
QSNMLASNQS MVAASGPHAF ADMMQQDPLG RLQGLDISSR DSHLVKSEGP SISAGEIVDI  360
AELKTAANFA ETLKLDLQNP SGIA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012456653.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-103RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D2VPV10.0A0A0D2VPV1_G
STRINGVIT_13s0067g02900.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-114bZIP family protein